PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 102921
Common NameMICPUN_102921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family CPP
Protein Properties Length: 621aa    MW: 62888.8 Da    PI: 9.3282
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
102921genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.72.6e-14263301241
     TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
             e+k+CnCkkskClk+YCeCfaag++C e C+C++C+N+++
  102921 263 ESKKCNCKKSKCLKLYCECFAAGVFCHE-CSCQNCQNTSD 301
             579************************9.********987 PP

2TCR53.16.5e-17334375142
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
             ++kkgC+Ckks ClkkYCeCf+ag+ C++ CkC++CkNke++
  102921 334 QHKKGCHCKKSACLKKYCECFQAGVLCQDYCKCDGCKNKEDN 375
             689************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-13262302IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.257263374IPR005172CRC domain
PfamPF036383.7E-12265299IPR005172CRC domain
SMARTSM011148.2E-17334375IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12336373IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MHADQAVLAA VHALAQSPLR PGVLDDVTDV AQLRKQLETH FDVNLTEPEA AHAGMARALE  60
EELRQLDGEL ELEQHATRLV RGGDVAPSPG GNPNDARGAN GRRSLRGAAA RGATGPAGVG  120
AVAAQAAEES MKRSSTTGAS TEWPHGLAKT LKNDGRDSPR VQSSRGNGKK SANGNAGGVA  180
PGGGGGSKSK KAGAGGGGGG GSIERLDQSA NAGGRRGGAQ GASDRRLSVS AAATPAVKGE  240
RPAGPLTTPS PTKDGEDPSK SCESKKCNCK KSKCLKLYCE CFAAGVFCHE CSCQNCQNTS  300
DNAGLVQMTR QQIELRNPNA FADKIVASGD GGGQHKKGCH CKKSACLKKY CECFQAGVLC  360
QDYCKCDGCK NKEDNGQFGG RGGAAAAKPI RMPTLSGHGT QAAAIAAVEE AAMFMASEND  420
HHGLIMEDLM HMKSPGRVGL INAGLMSPGR FGMGLMSPGR GLVMSPGRAV LAAVDGLGLD  480
LLQSPPKAAP PEAATPAAGS NASGGSNSVG ATPMKARGET VSPLTPGSGR GTILRAGPGR  540
LTLTGGSAIN TRSKAPPPRF DGKPNANSAK GPMVTPTVTR SSRKTRSFGA MSGSHDAALA  600
GGMITTLGSP VPLSTPEGFE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013300.0CP001330.1 Micromonas sp. RCC299 chromosome 11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002504796.10.0tso1-like transcription factor
TrEMBLC1EDG60.0C1EDG6_MICSR; Tso1-like transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3231530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-18Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]